If you are going to clone GFP to the amino terminal end of Your Favorite Protein...
If you are going to clone GFP to the amino terminal end of Your Favorite Protein (YFP), what adjustment must you make to the sequence(s)?
| a. |
Add a start codon to YFP |
|
| b. |
Remove the stop codon from GFP |
|
| c. |
Add a promoter between YFP and GFP |
|
| d. |
Add an activator sequence in front of GFP |
There may be multiple answer choices chosen.
Homework Answers
Request Answer!
We need at least 10 more requests to produce the answer.
0 / 10 have requested this problem solution
The more requests, the faster the answer.
Add Answer to:
If you are going to clone GFP to the amino terminal end of Your
Favorite Protein...
Your friend decides to place Green Fluorescent Protein (GFP) under the control of the promoter from...
Your friend decides to place Green Fluorescent Protein (GFP)
under the control of the promoter from the lacZ gene we discussed
in class. She put this expression plasmid into a bacterium. The
promoter from the lacZ gene is diagrammed to the right.?
2) Your friend decides to place Green Fluorescent Protein (GFP) under the control of the promoter from the lacZ gene we discussed in class. She put this expression plasmid into a bacterium. The promoter from the lacZ gene...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
INSTRUCTIONS You may print out this assignment and fill it in by hand. We suggest using...
INSTRUCTIONS You may print out this assignment and fill it in by hand. We suggest using pencil in case you make mistakes!! Submit your Assignment as a single doc on Canvas. ASSIGNMENT 1) For the DNA sequence given below, write the complementary DNA sequence that would complete the double-strand. DNA 3-A TTGCT TACTTGCA T-5° DNA 5 2) Does it matter which strand is the 'code strand'? The following two sequences look identical, except one runs 3-5' and the other 5'-3'....
C++: Translating mRNA sequence help Homework Description Codon 1 You are working in a bioinformatics lab...
C++: Translating mRNA sequence help
Homework Description Codon 1 You are working in a bioinformatics lab studying messenger RNA (mRNA) sequences. mRNA is a sequence of the nucleotide bases (Adenine, Cytosine, Guanine, and Uracil) that conveys information stored in DNA to Ribosomes for translation into proteins. The bases in the sequences are denoted by the first letters of the nucleotide bases (e.g. A, C, G, and U). A sequence of mRNA is made up of hundres to thousands of nucleotide...
Some amino acids are post-translationally removed from the C-terminal end of the beta-lactamase enzyme from B....
Some amino acids are post-translationally removed from the
C-terminal end of the beta-lactamase enzyme from B.
imaginarium (i.e. - after it is translated and
released from the ribosome, a protease chews off a some amino
acids). The wild-type enzyme, which has had the amino
acids removed from the C’-terminus, is 246 amino acids in length
and the C-terminal amino acids are shown below aligned with the
C-terminal amino acids of a frameshift mutant, which – due to a
frameshift mutation -...
O ACTIVITY 5.4.1 Synthesis of a Protein: A Simulation Activity In this activity, you will be...
O ACTIVITY 5.4.1 Synthesis of a Protein: A Simulation Activity In this activity, you will be provided with the DNA nucleotide sequence that codes for a hypothetical protein. The code will be provided to you in three fragments. You will have to tran- scribe the code into mRNA, remove an intron segment, and translate the mRNA into the protein. In addition, you will have to identify the beginning fragment the middle fragment, and the end fragment. Sequence A TCTTCCCTCCTAAACGTTCAACCGGTTCTTAATCCGC CGCCAGGGCCCCGCCCCTCAGAAGTTGGT...
Lab #14 Protein Synthesis Introduction Proteins are vital for the survival of an organism. Proteins make...
Lab #14 Protein Synthesis Introduction Proteins are vital for the survival of an organism. Proteins make enzymes and hormones which control reactions that must take place in the cell to survive.Proteins are made of basic units called amino acids. There are a total of 20 amino acids. Different proteins have different number and/or combination of amino acids. The kind of amino acid that is used when producing the protein depends on the 3-base code (codon) read from the RNA molecule...
can you guys please give me the correct answers and explain why? 19. You clone your...
can you guys please give me the correct answers and explain
why?
19. You clone your favorite E. coli gene including the promoter region, the open reading frame, and some flanking DNA. You determine the DNA sequence of the entire region and map the start site of transcription. You note the following sequence near the end o your gene. What is the likely function of this sequence? ...CCCAGCCCGCCTAATGAGCGGGCTTTTTTTTTTGAAGGTATAT... A. A polyadenylation signal B. A Rut site C. The ribosome binding...
Please answer only if you know how to!!! Please follow the directions and label clearly! On...
Please answer only if you know how to!!!
Please follow the directions and label
clearly!
On the next page is a small segment of DNA that includes one gene. The list below contains all th e information that must be encoded in that gene in order for both transcription and translation to occur correctly 1. On the DNA, LABEL the location of every item on the list. Hint: some locations will be approximate 2. In the space provided below the...
A small portion of the human transport protein amino acid sequence is shown below. The upper...
A small portion of the human transport protein amino acid sequence is shown below. The upper sequence is associated with darker skin, and the lower sequence is associated with lighter skin. What DNA base-pair change created the light-skin form of the human protein from the gene that coded for the dark-skir form? Ala-Gly Ala ThrPhe Ala Gly-Thr-Thr - Phe SECOND BASE SUAU TI Phe TUUU UUC UUA UUG] TUCU UCC UCA UCG Ser (UAC LUGU) UGC UAA Stop UAG Stop...
Your friend decides to place Green Fluorescent Protein (GFP)
under the control of the promoter from the lacZ gene we discussed
in class. She put this expression plasmid into a bacterium. The
promoter from the lacZ gene is diagrammed to the right.?
2) Your friend decides to place Green Fluorescent Protein (GFP) under the control of the promoter from the lacZ gene we discussed in class. She put this expression plasmid into a bacterium. The promoter from the lacZ gene...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
INSTRUCTIONS You may print out this assignment and fill it in by hand. We suggest using pencil in case you make mistakes!! Submit your Assignment as a single doc on Canvas. ASSIGNMENT 1) For the DNA sequence given below, write the complementary DNA sequence that would complete the double-strand. DNA 3-A TTGCT TACTTGCA T-5° DNA 5 2) Does it matter which strand is the 'code strand'? The following two sequences look identical, except one runs 3-5' and the other 5'-3'....
C++: Translating mRNA sequence help
Homework Description Codon 1 You are working in a bioinformatics lab studying messenger RNA (mRNA) sequences. mRNA is a sequence of the nucleotide bases (Adenine, Cytosine, Guanine, and Uracil) that conveys information stored in DNA to Ribosomes for translation into proteins. The bases in the sequences are denoted by the first letters of the nucleotide bases (e.g. A, C, G, and U). A sequence of mRNA is made up of hundres to thousands of nucleotide...
Some amino acids are post-translationally removed from the
C-terminal end of the beta-lactamase enzyme from B.
imaginarium (i.e. - after it is translated and
released from the ribosome, a protease chews off a some amino
acids). The wild-type enzyme, which has had the amino
acids removed from the C’-terminus, is 246 amino acids in length
and the C-terminal amino acids are shown below aligned with the
C-terminal amino acids of a frameshift mutant, which – due to a
frameshift mutation -...
O ACTIVITY 5.4.1 Synthesis of a Protein: A Simulation Activity In this activity, you will be provided with the DNA nucleotide sequence that codes for a hypothetical protein. The code will be provided to you in three fragments. You will have to tran- scribe the code into mRNA, remove an intron segment, and translate the mRNA into the protein. In addition, you will have to identify the beginning fragment the middle fragment, and the end fragment. Sequence A TCTTCCCTCCTAAACGTTCAACCGGTTCTTAATCCGC CGCCAGGGCCCCGCCCCTCAGAAGTTGGT...
Lab #14 Protein Synthesis Introduction Proteins are vital for the survival of an organism. Proteins make enzymes and hormones which control reactions that must take place in the cell to survive.Proteins are made of basic units called amino acids. There are a total of 20 amino acids. Different proteins have different number and/or combination of amino acids. The kind of amino acid that is used when producing the protein depends on the 3-base code (codon) read from the RNA molecule...
can you guys please give me the correct answers and explain
why?
19. You clone your favorite E. coli gene including the promoter region, the open reading frame, and some flanking DNA. You determine the DNA sequence of the entire region and map the start site of transcription. You note the following sequence near the end o your gene. What is the likely function of this sequence? ...CCCAGCCCGCCTAATGAGCGGGCTTTTTTTTTTGAAGGTATAT... A. A polyadenylation signal B. A Rut site C. The ribosome binding...
Please answer only if you know how to!!!
Please follow the directions and label
clearly!
On the next page is a small segment of DNA that includes one gene. The list below contains all th e information that must be encoded in that gene in order for both transcription and translation to occur correctly 1. On the DNA, LABEL the location of every item on the list. Hint: some locations will be approximate 2. In the space provided below the...
A small portion of the human transport protein amino acid sequence is shown below. The upper sequence is associated with darker skin, and the lower sequence is associated with lighter skin. What DNA base-pair change created the light-skin form of the human protein from the gene that coded for the dark-skir form? Ala-Gly Ala ThrPhe Ala Gly-Thr-Thr - Phe SECOND BASE SUAU TI Phe TUUU UUC UUA UUG] TUCU UCC UCA UCG Ser (UAC LUGU) UGC UAA Stop UAG Stop...
Most questions answered within 3 hours.
-
22. Suppose that each firm has the long run cost function
c(y) = y2 + 9...
asked 4 minutes ago -
Resting Metabolic Rate: Seated vs. Lying supine: What would be
happening physiologically that is different in...
asked 4 minutes ago -
What Volume (in mL) of KBr solution must be taken so it will
contain 2.83x10^-5 moles...
asked 22 minutes ago -
Dr Johnson invests $9,000 at the rate of 6% annual interest
compounded semi annually for 4...
asked 23 minutes ago -
The contribution format income statement for Huerra Company for
last year is given below:
Total
Unit...
asked 31 minutes ago -
How do I write a program in MIPs assembly that will take 2 words
from the...
asked 32 minutes ago -
two identical cars approach an intersection, one is traveling east
at 18n/s. the second is traveling...
asked 37 minutes ago -
When an X-ray beam with a wavelength of 133 pm is incident on
the surface to...
asked 47 minutes ago -
Compare and contrast the internal and external organization of
Congress and the President.
"2 paragraph"
asked 55 minutes ago -
Suppose that the average waiting time for a patient at a
physician's office is just over...
asked 1 hour ago -
C++
Can somebody help me with this
2 integer right triangles
There are right-angled triangles (i.e.,...
asked 1 hour ago -
A researcher at Lund University is interested in studying the
biological role of a so-called type...
asked 1 hour ago