Each protein is composed of a maximum of ____________ different amino acids in varying numbers and...
Each protein is composed of a maximum of ____________ different amino acids in varying numbers and sequences
Homework Answers
Each protein is composed of a maximum of 20 different amino acids in varying numbers and sequences.
Amino acids are linked through peptide bonds to form peptides. If large number of amino acids are combined then polypeptides are produced, these are known as proteins.
If the molecular weight of polypeptide is greater than 10000 g/mol then it is considered as protein.
So proteins are polymers of amino acids.
Add Answer to:
Each protein is composed of a maximum of ____________ different
amino acids in varying numbers and...
There are 20 different tRNA molecules, one for each of the 20 amino acids found in protein
There are 20 different tRNA molecules, one for each of the 20 amino acids found in protein. During protein synthesis, the job of a tRNA molecule is to carry its particular amino acid to the growing protein chain and find the correct amino acid position there. It does this by matching a 3- letter anticodon on the tRNA to a complementary 3-letter codon on mRNA. Below, in a diagram of a ERNA molecule, nucleotides are represented by small circles, some...
Question 8 2.5 pts If a protein (polypeptide) is composed of 210 amino acids, how many...
Question 8 2.5 pts If a protein (polypeptide) is composed of 210 amino acids, how many mRNA codons would be required? Question 9 2.5 pts If a protein (polypeptide) is composed of 210 amino acids, how many mRNA ribonucleotides would be required?
A protein composed of fifty amino-acids would require a minimum of _ nucleotides in the mRNA...
A protein composed of fifty amino-acids would require a minimum of _ nucleotides in the mRNA to represent all of the codons needed to correctly translate the protein. 50 O 100 147 150 153
6) Proteins are composed of amino acids polymerized into long chains. The structure of a protein...
6) Proteins are composed of amino acids polymerized into long chains. The structure of a protein - that is, its overall shape and how the chains are "folded” around each other - is very important for its function. In an aqueous environment, in an active, folded state the hydrophilic amino acids in the protein are facing outwards exposed to the water and the hydrophobic amino acids are hidden away from the water in the core of the protein. In a...
60) Lipids are composed of: c) fatty acids and glycerol amino acids and glycerol nucleic acids...
60) Lipids are composed of: c) fatty acids and glycerol amino acids and glycerol nucleic acids and glycerol fatty acids and water fatty acids and sugar e) 61) The bond between two amino acids is a: a) hydrogen bond b) covalent bond c) peptide bond d) b and c e) none of the above 62) Hemoglobin has which tertiary structure: a) fibrous b) globular c) four subunits--two alpha chains, two beta chains d) alpha helix e) none of the above...
How many different DNA sequences can be generated from a DNA sequence composed of 15 nucleotides...
How many different DNA sequences can be generated from a DNA sequence composed of 15 nucleotides (A, T, C or G)? How many different “biological information” can be produced from a protein sequence consisting of 15 amino acids?
Part B Assume a protein is composed of 115 amino acid residues and that each amino...
Part B Assume a protein is composed of 115 amino acid residues and that each amino acid can have three possible orlentations How many total possible orietations are thore do he rot Express the number of possible orientations to three significant figures. ΑΣφ 345 orientations Submit Incorrect; Try Again
Question 6 Which of the following statements regarding a protein with 4 domains must be true?...
Question 6 Which of the following statements regarding a protein with 4 domains must be true? A protein with 4 domains must have 4 different kinds of secondary structures. O A protein with 4 domains must be composed of 4 polypeptide chains. A protein with 4 domains must have 4 regions that fold independently. A protein with 4 domains must have a quaternary structure. Question 7 Histone proteins are typically... o rich in disulfide bonds O composed of a random...
Below, you can find a partial sequence of last 30 amino acids of a certain protein...
Below, you can find a partial sequence of last 30 amino acids of a certain protein (amino acids, single-letter code). There are also mutated sequences of the same protein. Explain which mutations could have happened. (pay attention to the sequence length and the sequence itself) (25) Original GVLSEGEWQLVLHVWAKVEADVAGHGQDIL Mutant 1 GVLSEGEWQLVLHV Mutant 2 GVLSEGEWQLVHVWAKVEADVAGHGQDIL Mutant 3 GVLQHDAWQLVLHVWAKVEADVAGHGQDIL Mutant 4 GVLSEGEWQLVLHVWAKVEAWLWVMGHEVMLQ Mutant 5 GVLSEGEWQLVLHVWAKVEADVAGHGQDILWALWQAEVGQLIGH
How many different amino acid sequences are possible in a polypeptide that is 10 amino acids...
How many different amino acid sequences are possible in a polypeptide that is 10 amino acids long: Select one: a. 10^20. b. 4120. O c. 10^4. d. 20-10. THEME
Question 8 2.5 pts If a protein (polypeptide) is composed of 210 amino acids, how many mRNA codons would be required? Question 9 2.5 pts If a protein (polypeptide) is composed of 210 amino acids, how many mRNA ribonucleotides would be required?
A protein composed of fifty amino-acids would require a minimum of _ nucleotides in the mRNA to represent all of the codons needed to correctly translate the protein. 50 O 100 147 150 153
6) Proteins are composed of amino acids polymerized into long chains. The structure of a protein - that is, its overall shape and how the chains are "folded” around each other - is very important for its function. In an aqueous environment, in an active, folded state the hydrophilic amino acids in the protein are facing outwards exposed to the water and the hydrophobic amino acids are hidden away from the water in the core of the protein. In a...
60) Lipids are composed of: c) fatty acids and glycerol amino acids and glycerol nucleic acids and glycerol fatty acids and water fatty acids and sugar e) 61) The bond between two amino acids is a: a) hydrogen bond b) covalent bond c) peptide bond d) b and c e) none of the above 62) Hemoglobin has which tertiary structure: a) fibrous b) globular c) four subunits--two alpha chains, two beta chains d) alpha helix e) none of the above...
Part B Assume a protein is composed of 115 amino acid residues and that each amino acid can have three possible orlentations How many total possible orietations are thore do he rot Express the number of possible orientations to three significant figures. ΑΣφ 345 orientations Submit Incorrect; Try Again
Question 6 Which of the following statements regarding a protein with 4 domains must be true? A protein with 4 domains must have 4 different kinds of secondary structures. O A protein with 4 domains must be composed of 4 polypeptide chains. A protein with 4 domains must have 4 regions that fold independently. A protein with 4 domains must have a quaternary structure. Question 7 Histone proteins are typically... o rich in disulfide bonds O composed of a random...
How many different amino acid sequences are possible in a polypeptide that is 10 amino acids long: Select one: a. 10^20. b. 4120. O c. 10^4. d. 20-10. THEME
Most questions answered within 3 hours.
-
Rice Products in Bangladesh
Business behavior is derived in large part from the basic cultural
environment...
asked 1 hour ago -
The following base sequence is found for a mRNA fragment from
wild-type E. coli: 5'- UAUCAGUAGAUAAUGUAACC-3'...
asked 1 hour ago -
For this exercise, round all regression parameters to three
decimal places.
One of the two tables...
asked 1 hour ago -
What is the 5% level of significance for mean = 3.60, standard
deviation = 0.94, and...
asked 1 hour ago -
Prior to beginning work on this discussion, please read the
article by Hayley Peterson, 15 Companies...
asked 2 hours ago -
Which pair of aqueous solutions, when mixed, will form a
precipitate?
A) NaNO3 and AgC2H3O2
B)...
asked 2 hours ago -
1-Write an algorithm to get two numbers from the user (as
inputs) and calculate the sum...
asked 5 hours ago -
Define white-collar crime. What is the difference between
offender and offense-based definitions of white-collar crime? What...
asked 6 hours ago -
Consider a reaction which is 1st order with respect to A and 1st
order with respect...
asked 6 hours ago -
c++
The length of the hypotenuse of a right-angled triangle is the
square root of the...
asked 6 hours ago -
When a metal rod is heated, not only its resistance but also its
length and cross‐sectional...
asked 6 hours ago -
write a c++ program that computes the L^1 - Norm of a given
vector (L^1 norm...
asked 6 hours ago