Interpretation of gene works in the following way. Proteins are the polymers of many amino acid building blocks.
Sequence of bases in a gene ( A, T, G, C) on template strand of DNA undergoes transcription to form mRNA , complementing the gene sequence.
Then codons on mRNA translate into different amino acids.
Start codon marks the site at which translation begins and stop codon marks the site at which it stops.
AUG is the start codon
UAA, UAG, UGA are the stop codons.
Lets look into the gene sequence in the question:
CTG TAC CCT GGT ACT GCC
after transcription the mRNA sequence will be:
GAC AUG GGA CCA UGA CGG
AUG will act as start codon and protein synthesis will start from there, UGA will act as stop codon
the amino acid sequence will be:
methionine glycine proline
5. Following the rules of protein synthesis, and using your book etc, as a guide, give...
DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2 Gene 1 Gene 3 DNA strand3 TRANSLATION Protein Trp Gly Model 2 ACTIVITY and QUESTIONS 1. Based on the information you can gather from model 1 complete the following sentences: a. The nucleotide Adenine (A) always pairs with the nucleotide b. The nucleotide Guanine (G) always pairs with the...
Please help with 4-10! DNA, Genes,and Protein Synthesis Activity 13: 2. The bases that interact with each other are called complementary bases. this definition and your answers to 1 complete the following: a. Thiamine (T) is the complementary base of b. Cytosine (C) is the complementary base of c. Adenine (A) is the complementary base of d. Guanine (G) is the complementary base of Based on 3. Shown below is the nucleotide sequence for one strand of a stretch of...
QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is composed of 44 amino acids with the po below. No information is available about its genetic sequence. Your task sequence for protein "Y". Assume that the gene sequence is unique in the human 5 BRIEFLY EXPLAIN methodically and accurately how you will decipher the gene seg "Y". (3 POINTS). no acid sequence of a human protein called "Y" using 1.44 amino acids with the...
Lab #14 Protein Synthesis Introduction Proteins are vital for the survival of an organism. Proteins make enzymes and hormones which control reactions that must take place in the cell to survive.Proteins are made of basic units called amino acids. There are a total of 20 amino acids. Different proteins have different number and/or combination of amino acids. The kind of amino acid that is used when producing the protein depends on the 3-base code (codon) read from the RNA molecule...
EXERCISE 10 PROTEIN SYNTHESIS Work with a partner to complete this exercise and answer the questions that follow. You will use the DNA strand from Exercise 8 to make the protein for which it codes. STEP 1 Review the imaginary strand of DNA below. Note the complementary base pairs. AGCAATCCGTCTTGG TCGTTAGGCAGAACC STEP 2 Draw the DNA strand separating down the middle (as in the beginning of DNA replication). STEP 3 Draw the free-floating RNA bases linking up with the top...
5. Hemoglobin is the protein found in red blood cells that transports oxygen from your lungs to your cells. Below is a segment of the DNA sequence that codes for a normal hemoglobin protein (the entire gene is much longer). Using the DNA sequence provided, transcribe the sequence into mRNA. Use the bottom strand as the coding strand. 5' ACTGCCCATGGTGCAC CIGACTCCTGAGGAG 3' 3' TGAC GG GIACCA CGT GGA CIGAG GACTCCTC 5 6. For hemoglobin, translate the mRNA strand from step...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
O ACTIVITY 5.4.1 Synthesis of a Protein: A Simulation Activity In this activity, you will be provided with the DNA nucleotide sequence that codes for a hypothetical protein. The code will be provided to you in three fragments. You will have to tran- scribe the code into mRNA, remove an intron segment, and translate the mRNA into the protein. In addition, you will have to identify the beginning fragment the middle fragment, and the end fragment. Sequence A TCTTCCCTCCTAAACGTTCAACCGGTTCTTAATCCGC CGCCAGGGCCCCGCCCCTCAGAAGTTGGT...
ANSWER THE FOLLOWING QUESTIONS 1) What is the relationship between a gene and a protein? 2) How does the tRNA contribute to protein synthesis? 3) The ability of cell to control their gene expression is called 4) What is a promoter? 5) What process convert the message from mRNA into amino acids? 6) The following expressions are true or false? Explain a. "A gene is any DNA sequence that is transcribed to any type of RNA b. "In eukaryotes, a...
Find the two other segments of the sequence among your classmates that will complete the protein. For example if you have a middle segment you will need to find a beginning and an end segment. Write the entire linear order of amino acids in Part 2, Question l in your proforma, (using the single letter amino acid abbreviation). Start with the beginning segment, followed by the middle segment and lastly, the end segment. Indicate the amino (NH2) and carboxyl (COOH)...