If you have an enzyme that has a primary sequence that is 429 amino acids in...
If you have an enzyme that has a primary sequence that is 429 amino acids in length, is it possible that both an amino acid position 215, as well as amino acids located at 342, and 401, can all be part of an active site of a protein? Explain why or why not?
Homework Answers
Answer: Yes
Explanation:
Proteins are heteropolymers of amino
acids linked together by peptide bonds. Proteins exhibit various
levels of structural organization.
Primary structure: The linear sequence of amino acids linked
together by peptide bonds
Secondary structure: Local conformation of the polypeptide backbone
Ex: Alpha helix and beta sheet
Tertiary structure: Overall #-dimensional conformation of the
protein
Quaternary structure: Interactions among individual subunits in a
multimeric protein
In the tertiary structure of a protein, the polypeptide chain is folded in a 3-dimensional manner so that amino acids that are far apart in the linear sequence can be brought adjacent to each other. Active site of many proteins contains amino acids that are far aprt in the linear sequence but are brought together by folding in 3D structure.
Add Answer to:
If you have an enzyme that has a primary sequence that is 429
amino acids in...
Which statement about enzyme catalysis is false? All of the active site amino acids are next...
Which statement about enzyme catalysis is false? All of the active site amino acids are next to each other in the primary sequence. Enzymes speed up reactions by forming specific non-covalent bonds between the enzyme amino acids and the transition state molecule. Some enzymes require other molecules, called cofactors, to carry out chemical reactions. Generally, the most important amino acids for an enzyme's function are those in the active site. Question 6 1 pt When [S] is much more than...
You are studying an interesting protein in nematode worms that is 100 amino acids in length....
You are studying an interesting protein in nematode worms that is 100 amino acids in length. Of particular interest is the fact that the last seven amino acids are all tryptophan (codons 94 through 100). Draw here the mRNA sequence for codons 94-100: Draw here the sequence of the DNA strand RNA polymerase used as its template (show 5' 3' polarity): You mutagenize the wild type worm. Assume for the next questions you are able to isolate both normal and...
QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is...
QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is composed of 44 amino acids with the po below. No information is available about its genetic sequence. Your task sequence for protein "Y". Assume that the gene sequence is unique in the human 5 BRIEFLY EXPLAIN methodically and accurately how you will decipher the gene seg "Y". (3 POINTS). no acid sequence of a human protein called "Y" using 1.44 amino acids with the...
Below, you can find a partial sequence of last 30 amino acids of a certain protein...
Below, you can find a partial sequence of last 30 amino acids of a certain protein (amino acids, single-letter code). There are also mutated sequences of the same protein. Explain which mutations could have happened. (pay attention to the sequence length and the sequence itself) (25) Original GVLSEGEWQLVLHVWAKVEADVAGHGQDIL Mutant 1 GVLSEGEWQLVLHV Mutant 2 GVLSEGEWQLVHVWAKVEADVAGHGQDIL Mutant 3 GVLQHDAWQLVLHVWAKVEADVAGHGQDIL Mutant 4 GVLSEGEWQLVLHVWAKVEAWLWVMGHEVMLQ Mutant 5 GVLSEGEWQLVLHVWAKVEADVAGHGQDILWALWQAEVGQLIGH
Week 14- Chapter 21 Homework Problem 21.72 < 52 of 58 Review Constants| Periodic Table Part A How does a point mutation for an enzyme affect the order of amino acids in that protein? Drag the term...
Week 14- Chapter 21 Homework Problem 21.72 < 52 of 58 Review Constants| Periodic Table Part A How does a point mutation for an enzyme affect the order of amino acids in that protein? Drag the terms on the left to the appropriate blanks on the right to complete the sentences. Reset Help then the order of amino acids will change in the of the polypeptide chain If the resulting codon still codes for the same amino acid, If the...
Some amino acids are post-translationally removed from the C-terminal end of the beta-lactamase enzyme from B....
Some amino acids are post-translationally removed from the C-terminal end of the beta-lactamase enzyme from B. imaginarium (i.e. - after it is translated and released from the ribosome, a protease chews off some amino acids). The wild-type enzyme, which has had the amino acids removed from the C’-terminus, is 246 amino acids in length and the C-terminal amino acids are shown below aligned with the C-terminal amino acids of a frameshift mutant, which – due to a frameshift mutation - is...
Some amino acids are post-translationally removed from the C-terminal end of the beta-lactamase enzyme from B....
Some amino acids are post-translationally removed from the C-terminal end of the beta-lactamase enzyme from B. imaginarium (i.e. - after it is translated and released from the ribosome, a protease chews off some amino acids). The wild-type enzyme, which has had the amino acids removed from the C’-terminus, is 246 amino acids in length and the C-terminal amino acids are shown below aligned with the C-terminal amino acids of a frameshift mutant, which – due to a frameshift mutation - is...
19. The _structure of a protein refers to the linear sequence of amino acids in that...
19. The _structure of a protein refers to the linear sequence of amino acids in that protein. 20. Make up an example of the primary structure of a protein in the space below 21. The structure of a protein refers to a regular, recurring arrangement of the amino acid chain. One such arrangement, called the occurs when the amino acid chain forms a spiral or coil. Draw an example of this structure in the space below. 22. Another type of_...
Protein Structure A protein contains a string of amino acids (usually more than 50) that has...
Protein Structure A protein contains a string of amino acids (usually more than 50) that has a biological function. 15ecause proteins are so large, their structure has several levels, all of which are important for the proper functioning of the protein. Ultimately, the sequence of amino acids (ordering of polar and nonpolar amino acids) dictates the 3-dimensional shape of a protein and this dictates its primary function. Level 1: Primary (1") The amino acid sequence of a polypeptide Protein Backbone...
2) A) Amino acids such as Phe and Val are not known to participate directly in acid-base or coval...
2) A) Amino acids such as Phe and Val are not known to participate directly in acid-base or covalent catalysis. Explain why B) Mutating a Phe and Val can still have dramatic effects on enzyme activity. Why?
2) A) Amino acids such as Phe and Val are not known to participate directly in acid-base or covalent catalysis. Explain why B) Mutating a Phe and Val can still have dramatic effects on enzyme activity. Why?
Which statement about enzyme catalysis is false? All of the active site amino acids are next to each other in the primary sequence. Enzymes speed up reactions by forming specific non-covalent bonds between the enzyme amino acids and the transition state molecule. Some enzymes require other molecules, called cofactors, to carry out chemical reactions. Generally, the most important amino acids for an enzyme's function are those in the active site. Question 6 1 pt When [S] is much more than...
You are studying an interesting protein in nematode worms that is 100 amino acids in length. Of particular interest is the fact that the last seven amino acids are all tryptophan (codons 94 through 100). Draw here the mRNA sequence for codons 94-100: Draw here the sequence of the DNA strand RNA polymerase used as its template (show 5' 3' polarity): You mutagenize the wild type worm. Assume for the next questions you are able to isolate both normal and...
QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is composed of 44 amino acids with the po below. No information is available about its genetic sequence. Your task sequence for protein "Y". Assume that the gene sequence is unique in the human 5 BRIEFLY EXPLAIN methodically and accurately how you will decipher the gene seg "Y". (3 POINTS). no acid sequence of a human protein called "Y" using 1.44 amino acids with the...
Week 14- Chapter 21 Homework Problem 21.72 < 52 of 58 Review Constants| Periodic Table Part A How does a point mutation for an enzyme affect the order of amino acids in that protein? Drag the terms on the left to the appropriate blanks on the right to complete the sentences. Reset Help then the order of amino acids will change in the of the polypeptide chain If the resulting codon still codes for the same amino acid, If the...
19. The _structure of a protein refers to the linear sequence of amino acids in that protein. 20. Make up an example of the primary structure of a protein in the space below 21. The structure of a protein refers to a regular, recurring arrangement of the amino acid chain. One such arrangement, called the occurs when the amino acid chain forms a spiral or coil. Draw an example of this structure in the space below. 22. Another type of_...
Protein Structure A protein contains a string of amino acids (usually more than 50) that has a biological function. 15ecause proteins are so large, their structure has several levels, all of which are important for the proper functioning of the protein. Ultimately, the sequence of amino acids (ordering of polar and nonpolar amino acids) dictates the 3-dimensional shape of a protein and this dictates its primary function. Level 1: Primary (1") The amino acid sequence of a polypeptide Protein Backbone...
2) A) Amino acids such as Phe and Val are not known to participate directly in acid-base or covalent catalysis. Explain why B) Mutating a Phe and Val can still have dramatic effects on enzyme activity. Why?
2) A) Amino acids such as Phe and Val are not known to participate directly in acid-base or covalent catalysis. Explain why B) Mutating a Phe and Val can still have dramatic effects on enzyme activity. Why?
Most questions answered within 3 hours.
-
Investor company owns 35% of investee company voting stock and
accounts for the investment under the...
asked 44 minutes ago -
The number of major faults on a randomly chosen 1 km stretch of
highway has a...
asked 1 hour ago -
Consider the competitive environment of Starbuck's, Progressive
Insurance, a manufacturing firm with low turnover, or a...
asked 1 hour ago -
3. Gains from trade
Consider two neighbouring island countries called Euphoria and
Contente. They each have...
asked 3 hours ago -
A business executive has the option to invest money in two
plans: Plan A guarantees that...
asked 6 hours ago -
Hello, can someone please help me answer this question?
How much heat is absorbed by a...
asked 6 hours ago -
. A marketing researcher conducted a survey of 25 shoppers
randomly selected at the local mall...
asked 6 hours ago -
Create an comprehensive response to the
following:
Antimicrobial agents work on a multitude of microbes (bacteria,...
asked 6 hours ago -
6.13 LAB: Step counter. Section 6.3.
A pedometer treats walking 2,000 steps as walking 1 mile....
asked 6 hours ago -
(14.2) A block of mass m = 10 kg riding on a frictionless
horizontal plane is...
asked 6 hours ago -
Use any search engine to search for articles about Starbucks
partnership with Tata Companies in India...
asked 6 hours ago -
Let’s say that for some reason Bank Excess Reserves suddenly
increase sharply. What effect would this...
asked 6 hours ago