Homework Answers
A) In the given sequence, polar aminoacids are Lysine (L), Arginine (R), Serine (S), Threonine (T)
Non-polar aminoacids are Alanine (A), Valine (V), Leucine (L), Isoleucine (I), Proline (P)
Global alignment uses all the portions to align.
Sequence 1 VLLVAKKRITSVVPKR
Sequence 2 ILLVKKKLTTVVLPKK
Alignment:
VLLV A KKRITSVVP _ KR
ILLV _ KKKLTTVVL P KK
Add Answer to:
5. Biophysics
5. Based only on polarity of the amino acids (i.e., two non-identical amino acids...
Consider two homologous DNA sequences, GATTC and CCATG. Use the Needleman-Wunsch algorithm to find the optimal...
Consider two homologous DNA sequences, GATTC and CCATG.
Use the Needleman-Wunsch algorithm to find the optimal
global alignment between these two sequences. Use a linear
gap penalty of -4 and the substitution matrix provided below. The
dynamic programming matrix is already outlined below, you just need
to fill it according to the algorithm. Be sure to write out your
final alignment!
substitution matrix A C GT A 10 -5 0 -5 C -5 10 -5 0 G 0 -5 10...
"R" group polarity nonpolar, polar, or polar with H- bonds. 1. choose any two know amino acids with similar Rf and based...
"R" group polarity nonpolar, polar, or polar with H-
bonds.
1. choose any two know amino acids with similar Rf and based on the
size and polarity of their side chains, give an explanation for why
their retention factors are similar.
2. choose any two known amino acids with very different Rf values
and based on the size and polarity of their side chains, give an
explanation for why their retention factors are dissimilar.
3. Explain why lysines Rf is...
*SOLVE QS 13 ONLY 11. (5 pts) We would like to align two DNA sequences: (v)GATTCGT, and (w) GAATTAGTT based on the following scoring scheme as discussed in class: s(i i-1 if v w (matches) ii) s(i, j)...
*SOLVE QS 13 ONLY
11. (5 pts) We would like to align two DNA sequences: (v)GATTCGT, and (w) GAATTAGTT based on the following scoring scheme as discussed in class: s(i i-1 if v w (matches) ii) s(i, j) = 0 if vis wh (mismatches); ii) d 0 What would be the maximum alignment score? Explain how you get the result. (indels: insertions or deletions). 12. (5 pts) Align the same two sequences in the previous problem with the new scoring...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
The following gene sequence has been obtained (only for the first few amino acids). You are...
The following gene sequence has been obtained (only for the first few amino acids). You are provided with the following gRNA spacer sequence to target a specific region of this gene: You are also provided with the following repair template sequence to introduce a specific mutation in this sequence through homology-directed repair (HDR): What is the mutation introduced by this repair template? What are the consequences of this mutation? (2pts) What would be possible sequences of two forward primers that...
questions 25,62,54,77 25. At the end of Meiosis I, which best describes the chromosomes in the...
questions 25,62,54,77
25. At the end of Meiosis I, which best describes the chromosomes in the cells? A) DNA replication in the S phase has led to a doubling in chromosome number. B) The cells contain the haploid number of chromosomes. C) Chromosome number and structure are identical to the beginning of the S phase. D) The cells contain the diploid number of chromosomes. E)The chromosome number remains the same,but the DNA content is half the original cel. g påtterns...
and w Two-dimensional gel electrophoresis separates proteins based on a. shape; charge Ob.size; concentration c. concentration;...
and w Two-dimensional gel electrophoresis separates proteins based on a. shape; charge Ob.size; concentration c. concentration; shape O d. size, charge O e. size; shape Refer to the table. Several strains of a bacterium are sequenced to investigate the pan and core genomes. In the table, + denotes presence of the gene and denotes its absence. Gene Gene Gene Gene Gene Strain ! Strain 2 + Strain 3 + Strain 4 + + + + Strain 5 + + What...
What an Executive Summary Is An executive summary is a specific type of document that does...
What an Executive Summary Is
An executive summary is a specific type of document that does
two things: it summarizes a research article, and it offers
recommendations as to how information from the article can be
used.
Some long reports can contain an executive summary section, as
indicated in the Pearson handbook.
Write a 2 pahe Executive Summary
In business contexts, an executive summary is always written
for a specific purpose: to explain the information in the article
to a...
Consider two homologous DNA sequences, GATTC and CCATG.
Use the Needleman-Wunsch algorithm to find the optimal
global alignment between these two sequences. Use a linear
gap penalty of -4 and the substitution matrix provided below. The
dynamic programming matrix is already outlined below, you just need
to fill it according to the algorithm. Be sure to write out your
final alignment!
substitution matrix A C GT A 10 -5 0 -5 C -5 10 -5 0 G 0 -5 10...
"R" group polarity nonpolar, polar, or polar with H-
bonds.
1. choose any two know amino acids with similar Rf and based on the
size and polarity of their side chains, give an explanation for why
their retention factors are similar.
2. choose any two known amino acids with very different Rf values
and based on the size and polarity of their side chains, give an
explanation for why their retention factors are dissimilar.
3. Explain why lysines Rf is...
*SOLVE QS 13 ONLY
11. (5 pts) We would like to align two DNA sequences: (v)GATTCGT, and (w) GAATTAGTT based on the following scoring scheme as discussed in class: s(i i-1 if v w (matches) ii) s(i, j) = 0 if vis wh (mismatches); ii) d 0 What would be the maximum alignment score? Explain how you get the result. (indels: insertions or deletions). 12. (5 pts) Align the same two sequences in the previous problem with the new scoring...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
questions 25,62,54,77
25. At the end of Meiosis I, which best describes the chromosomes in the cells? A) DNA replication in the S phase has led to a doubling in chromosome number. B) The cells contain the haploid number of chromosomes. C) Chromosome number and structure are identical to the beginning of the S phase. D) The cells contain the diploid number of chromosomes. E)The chromosome number remains the same,but the DNA content is half the original cel. g påtterns...
and w Two-dimensional gel electrophoresis separates proteins based on a. shape; charge Ob.size; concentration c. concentration; shape O d. size, charge O e. size; shape Refer to the table. Several strains of a bacterium are sequenced to investigate the pan and core genomes. In the table, + denotes presence of the gene and denotes its absence. Gene Gene Gene Gene Gene Strain ! Strain 2 + Strain 3 + Strain 4 + + + + Strain 5 + + What...
What an Executive Summary Is
An executive summary is a specific type of document that does
two things: it summarizes a research article, and it offers
recommendations as to how information from the article can be
used.
Some long reports can contain an executive summary section, as
indicated in the Pearson handbook.
Write a 2 pahe Executive Summary
In business contexts, an executive summary is always written
for a specific purpose: to explain the information in the article
to a...
Most questions answered within 3 hours.
-
At a certain temperature, the equilibrium constant, Kc, for this
reaction is 53.3.
H2(g)+I2(g)−⇀↽−2HI(g)Kc=53.3
At this...
asked 54 minutes ago -
Question1 ) The STL provides similiar classes called stack and
queue, both of which gave functions...
asked 1 hour ago -
For Questions 1-4, assume you have 5 bits available:
1. For (positive) integers: What is the...
asked 1 hour ago -
convert grams into vloume with the density of water being at
.997514 g/cm^3 at 23.1 Celsuis...
asked 3 hours ago -
Foreman company obtained a $20,000, 6% loan on May 1, 2018.
Principal and interest will be...
asked 4 hours ago -
5. Problem 11.05 (Discounted Payback)
eBook
Project L costs $60,000, its expected cash inflows are $14,000
per...
asked 4 hours ago -
1. Which of the following is true about politics and health
organizations?
A. Health organizations are...
asked 4 hours ago -
A space vehicle is coasting at a constant velocity of 18.1 m/s
in the +y direction...
asked 5 hours ago -
5) Use the following balanced equation to answer questions
(a)-(i).
3 Cu(s) + 8 HNO3(aq) →...
asked 5 hours ago -
A three-year maturity bond with a 12% annual coupon rate is
currently traded at par $1000...
asked 5 hours ago -
1.
What is the minimum volume to use in the Spec 20 cuvette in order
to...
asked 6 hours ago -
A builder wants to install wall-to-wall carpeting in a living
room of length 8.87 m and...
asked 6 hours ago