ZuoTi.Pro
Question

Cystic fibrosis gene is 300,000 base pairs long. The transcribed portion of the gene spans 250,000...

Cystic fibrosis gene is 300,000 base pairs long. The transcribed portion of the gene spans 250,000 base pairs of DNA. The cytoplasmic mRNA for this gene is 6500 bases long. The protein is 1480 amino acids long. The sum of bases coding for introns is approximately:

science   biology   
0 0
Add a comment Improve this question Transcribed image text
Next > < Previous
Sort answers by oldest

Homework Answers

Answer #1

The introns of cystic fibrosis gene - 9

The introns of Transcribed portion of gene is - 2

The introns of cytoplasmic mRNA - 71

The introns ofprotein is - 1843

The sum of bases coding for introns are 1925 introns. This result is obtained from intron sequence from gene database with the help of NCBI

0 0
Add a comment
Know the answer?
Add Answer to:
Cystic fibrosis gene is 300,000 base pairs long. The transcribed portion of the gene spans 250,000...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Log In

Sign Up

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions

  • The BRCA1 gene is very large, spanning roughly 100,000 base pairs. However, the functional mRNA from...

    The BRCA1 gene is very large, spanning roughly 100,000 base pairs. However, the functional mRNA from this gene is only 7,800 bases long. This difference is best explained by: A. Only a small region of the gene called ‘the exons’ are transcribed. B. The primary transcript is processed to remove many large introns. C. Unneeded regions of the mRNA at the 5’- and 3’-ends are removed during processing D. The mRNA is partially degraded after it is transcribed.

  • Consider the most common Cystic Fibrosis variant: Wild-type CFTR DNA (Coding-strand): 3 ATC ATC TTT GGT...

    Consider the most common Cystic Fibrosis variant: Wild-type CFTR DNA (Coding-strand): 3 ATC ATC TTT GGT GTT atc att ggt gtt... Cystic Fibrosis odi 1. Add the 5' and 3' designations to the DNA. 2. Write the template sequence for the DNA 3. Transcribe the wild-type and CF DNA into mRNA. Be sure to include the 5'/3' labels. 4. Translate the wild-type and CF mRNA into protein. Be sure to label these ends also. 5. In the above wild-type protein,...

  • QUESTION 7 If the MC1R protein is 317 amino acids long why are there 954 base...

    QUESTION 7 If the MC1R protein is 317 amino acids long why are there 954 base pairs in the coding region of the gene? Each amino acid has a mRNA codon and DNA triplet consisting of a three-base sequence. (317 x 3951 plus a stop codon (951-3-954) to signal the end of translation) Because there are 317 proteins in the MC1R code. mutant proteins always have 954 base pairs. Each amino acid has a mRNA codon and DNA triplet consisting...

  • Question 2: Transcription, RNA Processing and Translation A particular gene codes for a mature mRNA transcript...

    Question 2: Transcription, RNA Processing and Translation A particular gene codes for a mature mRNA transcript containing 1200 bases, which is translated into a protein containing 300 amino acids. A. How long is the coding sequence in this mRNA and how many nucleotides are in the UTRs? For the purposes of this question we are ignoring the G’ cap and the polyA tail. B. A mutant form of the gene created by one nucleotide being changed to another nucleotide also...

  • want to double check! 25. Th e DNA sequences encoding the initiation whese parated bcoding the...

    want to double check! 25. Th e DNA sequences encoding the initiation whese parated bcoding the initiation and termination codons of a certain protein amino acids in length. there of the protei nucleotides on a certain organism's chromosome; however ssuming that there has been no post-translational processing elined from this gene is translated, the protein product is only 250 A. The RNA was synthesized in a bacterial cell n, what can you conclude from these observations? The RNA was synthesized...

  • Augu Q46. Below is a DNA sequence from a yeast GPCR gene. Using RNA sequencing methods...

    Augu Q46. Below is a DNA sequence from a yeast GPCR gene. Using RNA sequencing methods you have obtained the following partial 5' sequence for the MRNA transcribed from this gene: 5'-GGUCCAU... 5'GTATAAGAAGCACTCTACCTCAATGGGTCCATGGGAGAAGGTAGGCATGTGTATTTGACAAAGGGA i. What are the most likely six N-terminal amino acids for the above gene? (2 pts) Examine the other reading frames. Explain why you can exclude those other possible reading frames from consideration (one or two reasons depending upon the frame). (2 pts) Circle the portion of...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

  • QUESTION 1 George Beadle and Edward Tatum performed an experiment in which they made single-gene mutations...

    QUESTION 1 George Beadle and Edward Tatum performed an experiment in which they made single-gene mutations in the bread mold Neurospora crassa. These mutations resulted in several Neurospora auxotrophs. Further analysis revealed specifically how the mutations affected synthesis of the amino acid in question. What was the significance of these results? A single gene encodes a single protein, in the case of this experiment, an enzyme. Enzymes are needed to synthesize amino acids. They showed that mutations are heritable. They...

  • DNA DNA Replication: ONA Because DNA Is the ge m Tumes and heart e ine in...

    DNA DNA Replication: ONA Because DNA Is the ge m Tumes and heart e ine in process called DNA curs in the nucleus of s acest FS Parent strand Parent strand Newly replicated DNA Newly replicated DNA- SA0 Daughter DNA molecule Daughter DNA molecule Figure 8.2: Overview of DNA replication and illustration of complementary base pairing. DNA must replicate before cell division so that each new daughter cell receives an exact copy of the parent DNA. 1. Replication begins when...

  • 13. Why are ribonucleoside triphosphates the monomers required for RNA synthesis rather than ribonucleoside monophosphates? A....

    13. Why are ribonucleoside triphosphates the monomers required for RNA synthesis rather than ribonucleoside monophosphates? A. Only ribonucleoside triphosphates contain the sugar ribose. B. Ribonucleoside triphosphates have low potential energy, making the polymerization reaction endergonic. C. Ribonucleoside triphosphates have high potential energy, making the polymerization reaction exergonic. D. Ribonucleoside monophosphates cannot form complementary base pairs with the DNA template. E. Ribonucleoside triphosphates are not used, rather all use deoxyriboside triphosphates. 14. How is a mutation in a bacterial cell that...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT
ADVERTISEMENT